![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
![]() | Protein Frv operon protein FrvX, catalytic domain [117659] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [117660] (3 PDB entries) Uniprot O59196 # PH1527 |
![]() | Domain d1y0ra3: 1y0r A:6-72,A:164-351 [161363] Other proteins in same PDB: d1y0ra1 complexed with ars, zn |
PDB Entry: 1y0r (more details), 1.75 Å
SCOPe Domain Sequences for d1y0ra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0ra3 c.56.5.4 (A:6-72,A:164-351) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi aahmdqiXwdgrlerlgkhrfvsiafddriavytilevakqlkdakadvyfvatvqeevg lrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgtaikimdrsvichptivr wleelakkheipyqleillgggtdagaihltkagvptgalsvparyihsntevvderdvd atvelmtkalenihel
Timeline for d1y0ra3: