Lineage for d1xwdf_ (1xwd F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834895Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 1834902Protein Follicle-stimulating hormone receptor [159450] (1 species)
  7. 1834903Species Human (Homo sapiens) [TaxId:9606] [159451] (1 PDB entry)
    Uniprot P23945 18-259
  8. 1834905Domain d1xwdf_: 1xwd F: [161362]
    Other proteins in same PDB: d1xwda_, d1xwdb1, d1xwdd_, d1xwde_
    automated match to d1xwdc1
    complexed with nag, so4

Details for d1xwdf_

PDB Entry: 1xwd (more details), 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor
PDB Compounds: (F:) Follicle stimulating hormone receptor

SCOPe Domain Sequences for d1xwdf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwdf_ c.10.2.7 (F:) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
chhrichcsnrvflcqeskvteipsdlprnaielrfvltklrviqkgafsgfgdlekiei
sqndvlevieadvfsnlpklheiriekannllyinpeafqnlpnlqyllisntgikhlpd
vhkihslqkvlldiqdninihtiernsfvglsfesvilwlnkngiqeihncafngtqlde
lnlsdnnnleelpndvfhgasgpvildisrtrihslpsyglenlkklrarsty

SCOPe Domain Coordinates for d1xwdf_:

Click to download the PDB-style file with coordinates for d1xwdf_.
(The format of our PDB-style files is described here.)

Timeline for d1xwdf_: