Lineage for d1xeqb_ (1xeq B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311088Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (3 species)
  7. 2311097Species Influenza B virus [TaxId:11520] [140389] (1 PDB entry)
    Uniprot P03502 15-103
  8. 2311099Domain d1xeqb_: 1xeq B: [161361]
    automated match to d1xeqa1
    complexed with br

Details for d1xeqb_

PDB Entry: 1xeq (more details), 2.1 Å

PDB Description: Crystal tructure of RNA binding domain of influenza B virus non-structural protein
PDB Compounds: (B:) Nonstructural protein NS1

SCOPe Domain Sequences for d1xeqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xeqb_ a.16.1.1 (B:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza B virus [TaxId: 11520]}
qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
nkrmsleerkaigvkmmkvllfmdp

SCOPe Domain Coordinates for d1xeqb_:

Click to download the PDB-style file with coordinates for d1xeqb_.
(The format of our PDB-style files is described here.)

Timeline for d1xeqb_: