SCOPe 2.05: Domain d1xeqb_: 1xeq B:

Lineage for d1xeqb_ (1xeq B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (2 species)

7. Species Influenza B virus [TaxId:11520] [140389] (1 PDB entry)
   Uniprot P03502 15-103

8. Domain d1xeqb_: 1xeq B: [161361]
   automated match to d1xeqa1
   complexed with br

Details for d1xeqb_

PDB Entry: 1xeq, 2.1 Å

PDB Description: Crystal tructure of RNA binding domain of influenza B virus non-structural protein

PDB Compounds: (B:) Nonstructural protein NS1

SCOPe Domain Sequences for d1xeqb_:

Sequence; same for both SEQRES and ATOM records:

>d1xeqb_ a.16.1.1 (B:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza B virus [TaxId: 11520]}
qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
nkrmsleerkaigvkmmkvllfmdp

Timeline for d1xeqb_:

• d1xeqb_ first appeared in SCOPe 2.01
  
• d1xeqb_ appears in SCOPe 2.04
  
• d1xeqb_ appears in SCOPe 2.06
  
• d1xeqb_ appears in the current release, SCOPe 2.08