SCOPe 2.02: Domain d1wd6b_: 1wd6 B:

Lineage for d1wd6b_ (1wd6 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins)

6. Protein automated matches [190315] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187130] (1 PDB entry)

8. Domain d1wd6b_: 1wd6 B: [161359]
   Other proteins in same PDB: d1wd6a_
   automated match to d2asya1

Details for d1wd6b_

PDB Entry: 1wd6, 2.9 Å

PDB Description: crystal structure of JW1657 from Escherichia coli

PDB Compounds: (B:) Protein ydhR

SCOPe Domain Sequences for d1wd6b_:

Sequence; same for both SEQRES and ATOM records:

>d1wd6b_ d.58.4.12 (B:) automated matches {Escherichia coli [TaxId: 562]}
atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
alaylekhtarlknlgveevvakvfdvneplsqinq

Timeline for d1wd6b_:

• d1wd6b_ first appeared in SCOPe 2.01
  
• d1wd6b_ appears in SCOPe 2.03
  
• d1wd6b_ appears in the current release, SCOPe 2.08