| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family) ![]() |
| Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins) |
| Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species) |
| Species Escherichia coli [TaxId:562] [74866] (5 PDB entries) |
| Domain d1vrsc_: 1vrs C: [161357] Other proteins in same PDB: d1vrsd_, d1vrse_, d1vrsf_ automated match to d1vrsa1 |
PDB Entry: 1vrs (more details), 2.85 Å
SCOPe Domain Sequences for d1vrsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrsc_ b.1.17.1 (C:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
sqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhed
efygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplse
Timeline for d1vrsc_: