Lineage for d1vrsc_ (1vrs C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937472Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family) (S)
  5. 937473Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)
  6. 937474Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species)
  7. 937475Species Escherichia coli [TaxId:562] [74866] (5 PDB entries)
  8. 937482Domain d1vrsc_: 1vrs C: [161357]
    Other proteins in same PDB: d1vrsd_, d1vrse_, d1vrsf_
    automated match to d1vrsa1

Details for d1vrsc_

PDB Entry: 1vrs (more details), 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD
PDB Compounds: (C:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1vrsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrsc_ b.1.17.1 (C:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
sqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhed
efygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplse

SCOPe Domain Coordinates for d1vrsc_:

Click to download the PDB-style file with coordinates for d1vrsc_.
(The format of our PDB-style files is described here.)

Timeline for d1vrsc_: