Lineage for d1tfka_ (1tfk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008616Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 3008617Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) (S)
  5. 3008618Family d.243.1.1: Colicin D nuclease domain [102825] (1 protein)
    automatically mapped to Pfam PF11429
  6. 3008619Protein Colicin D nuclease domain [102826] (1 species)
    tRNA-specific ribonuclease
  7. 3008620Species Escherichia coli [TaxId:562] [102827] (3 PDB entries)
  8. 3008623Domain d1tfka_: 1tfk A: [161354]
    Other proteins in same PDB: d1tfkb2, d1tfkb3
    automated match to d1tfoa1
    complexed with mes

Details for d1tfka_

PDB Entry: 1tfk (more details), 2.1 Å

PDB Description: ribonuclease from escherichia coli complexed with its inhibtor protein
PDB Compounds: (A:) Colicin D

SCOPe Domain Sequences for d1tfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfka_ d.243.1.1 (A:) Colicin D nuclease domain {Escherichia coli [TaxId: 562]}
qldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyrrekgskvyfnpnt
mnvviiksngeflsgwkinpdadngriyletgel

SCOPe Domain Coordinates for d1tfka_:

Click to download the PDB-style file with coordinates for d1tfka_.
(The format of our PDB-style files is described here.)

Timeline for d1tfka_: