Lineage for d1sd3a_ (1sd3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523133Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2523200Domain d1sd3a_: 1sd3 A: [161352]
    automated match to d1lb8a_
    complexed with sym

Details for d1sd3a_

PDB Entry: 1sd3 (more details), 1.8 Å

PDB Description: crystal structure of the glur6 ligand binding core in complex with 2s, 4r-4-methylglutamate at 1.8 angstrom resolution
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d1sd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sd3a_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkyg
aqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpid
saddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqeeg
klhmmkekwwr

SCOPe Domain Coordinates for d1sd3a_:

Click to download the PDB-style file with coordinates for d1sd3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sd3a_: