SCOPe 2.07: Domain d1rp0b_: 1rp0 B:

Lineage for d1rp0b_ (1rp0 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.6: Thi4-like [141942] (2 proteins)
   Pfam PF01946; stand-alone, moderately decorated domain

6. Protein Thiazole biosynthetic enzyme Thi4 [141943] (2 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141945] (1 PDB entry)
   Uniprot Q38814 51-328
   chloroplast

8. Domain d1rp0b_: 1rp0 B: [161346]
   automated match to d1rp0a1
   complexed with ahz, hto, zn

Details for d1rp0b_

PDB Entry: 1rp0, 1.6 Å

PDB Description: Crystal Structure of Thi1 protein from Arabidopsis thaliana

PDB Compounds: (B:) Thiazole biosynthetic enzyme

SCOPe Domain Sequences for d1rp0b_:

Sequence; same for both SEQRES and ATOM records:

>d1rp0b_ c.3.1.6 (B:) Thiazole biosynthetic enzyme Thi4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ydlnaftfdpikesivsremtrrymtdmityaetdvvvvgagsaglsaayeisknpnvqv
aiieqsvspgggawlggqlfsamivrkpahlfldeigvaydeqdtyvvvkhaalftstim
skllarpnvklfnavaaedlivkgnrvggvvtnwalvaqnhhtqscmdpnvmeakivvss
cghdgpfgatgvkrlksigmidhvpgmkaldmntaedaivrltrevvpgmivtgmevaei
dgaprmgptfgammisgqkagqlalkalglpnaidgtl

Timeline for d1rp0b_:

• d1rp0b_ first appeared in SCOPe 2.01
  
• d1rp0b_ appears in SCOPe 2.06
  
• d1rp0b_ appears in the current release, SCOPe 2.08