Lineage for d1rp0b_ (1rp0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2850254Family c.3.1.6: Thi4-like [141942] (2 proteins)
    Pfam PF01946; stand-alone, moderately decorated domain
  6. 2850255Protein Thiazole biosynthetic enzyme Thi4 [141943] (2 species)
  7. 2850263Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141945] (1 PDB entry)
    Uniprot Q38814 51-328
    chloroplast
  8. 2850265Domain d1rp0b_: 1rp0 B: [161346]
    automated match to d1rp0a1
    complexed with ahz, hto, zn

Details for d1rp0b_

PDB Entry: 1rp0 (more details), 1.6 Å

PDB Description: Crystal Structure of Thi1 protein from Arabidopsis thaliana
PDB Compounds: (B:) Thiazole biosynthetic enzyme

SCOPe Domain Sequences for d1rp0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp0b_ c.3.1.6 (B:) Thiazole biosynthetic enzyme Thi4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ydlnaftfdpikesivsremtrrymtdmityaetdvvvvgagsaglsaayeisknpnvqv
aiieqsvspgggawlggqlfsamivrkpahlfldeigvaydeqdtyvvvkhaalftstim
skllarpnvklfnavaaedlivkgnrvggvvtnwalvaqnhhtqscmdpnvmeakivvss
cghdgpfgatgvkrlksigmidhvpgmkaldmntaedaivrltrevvpgmivtgmevaei
dgaprmgptfgammisgqkagqlalkalglpnaidgtl

SCOPe Domain Coordinates for d1rp0b_:

Click to download the PDB-style file with coordinates for d1rp0b_.
(The format of our PDB-style files is described here.)

Timeline for d1rp0b_: