Lineage for d1pdnc2 (1pdn C:67-124)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 905282Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 905611Family a.4.1.5: Paired domain [46748] (3 proteins)
    duplication: consists of two domains of this fold
  6. 905612Protein Paired protein (prd) [46751] (1 species)
  7. 905613Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46752] (1 PDB entry)
  8. 905615Domain d1pdnc2: 1pdn C:67-124 [161345]
    protein/DNA complex; mutant

Details for d1pdnc2

PDB Entry: 1pdn (more details), 2.5 Å

PDB Description: crystal structure of a paired domain-dna complex at 2.5 angstroms resolution reveals structural basis for pax developmental mutations
PDB Compounds: (C:) protein (prd paired)

SCOPe Domain Sequences for d1pdnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdnc2 a.4.1.5 (C:67-124) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
viggskpriatpeienrieeykrsspgmfsweirekliregvcdrstapsvsaisrlv

SCOPe Domain Coordinates for d1pdnc2:

Click to download the PDB-style file with coordinates for d1pdnc2.
(The format of our PDB-style files is described here.)

Timeline for d1pdnc2: