![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.5: Paired domain [46748] (3 proteins) duplication: consists of two domains of this fold |
![]() | Protein Paired protein (prd) [46751] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46752] (1 PDB entry) |
![]() | Domain d1pdnc2: 1pdn C:67-124 [161345] protein/DNA complex; mutant |
PDB Entry: 1pdn (more details), 2.5 Å
SCOPe Domain Sequences for d1pdnc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdnc2 a.4.1.5 (C:67-124) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} viggskpriatpeienrieeykrsspgmfsweirekliregvcdrstapsvsaisrlv
Timeline for d1pdnc2: