SCOPe 2.05: Domain d1pdnc1: 1pdn C:2-66

Lineage for d1pdnc1 (1pdn C:2-66)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.5: Paired domain [46748] (3 proteins)
   duplication: consists of two domains of this fold

6. Protein Paired protein (prd) [46751] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46752] (1 PDB entry)

8. Domain d1pdnc1: 1pdn C:2-66 [161344]
   protein/DNA complex; mutant

Details for d1pdnc1

PDB Entry: 1pdn, 2.5 Å

PDB Description: crystal structure of a paired domain-dna complex at 2.5 angstroms resolution reveals structural basis for pax developmental mutations

PDB Compounds: (C:) protein (prd paired)

SCOPe Domain Sequences for d1pdnc1:

Sequence; same for both SEQRES and ATOM records:

>d1pdnc1 a.4.1.5 (C:2-66) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qgrvnqlggvfingrplpnnirlkivemaadgirpcvisrqlrvshgcvskilnryqetg
sirpg

Timeline for d1pdnc1:

• d1pdnc1 first appeared in SCOPe 2.01
  
• d1pdnc1 appears in SCOPe 2.04
  
• d1pdnc1 appears in SCOPe 2.06
  
• d1pdnc1 appears in the current release, SCOPe 2.08