| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.5: Paired domain [46748] (3 proteins) duplication: consists of two domains of this fold |
| Protein Paired protein (prd) [46751] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46752] (1 PDB entry) |
| Domain d1pdnc1: 1pdn C:2-66 [161344] protein/DNA complex; mutant |
PDB Entry: 1pdn (more details), 2.5 Å
SCOPe Domain Sequences for d1pdnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdnc1 a.4.1.5 (C:2-66) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qgrvnqlggvfingrplpnnirlkivemaadgirpcvisrqlrvshgcvskilnryqetg
sirpg
Timeline for d1pdnc1: