Lineage for d1d2qb_ (1d2q B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777555Protein automated matches [190204] (3 species)
    not a true protein
  7. 2777556Species Human (Homo sapiens) [TaxId:9606] [186956] (13 PDB entries)
  8. 2777583Domain d1d2qb_: 1d2q B: [161337]
    Other proteins in same PDB: d1d2qa_
    automated match to d1d0ga_

Details for d1d2qb_

PDB Entry: 1d2q (more details), 2.8 Å

PDB Description: crystal structure of human trail
PDB Compounds: (B:) tnf-related apoptosis inducing ligand

SCOPe Domain Sequences for d1d2qb_:

Sequence, based on SEQRES records: (download)

>d1d2qb_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihekg
fyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygly
siyqggifelkendrifvsvtnehlidmdheasffgaflvg

Sequence, based on observed residues (ATOM records): (download)

>d1d2qb_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvaahitgtrgntlsknekalgrkinswessghsflsnlhlrngelvihekgfyyiysqt
yfrqmvqyiykytsypdpillmksarnscyglysiyqggifelkendrifvsvtnehlid
mdheasffgaflvg

SCOPe Domain Coordinates for d1d2qb_:

Click to download the PDB-style file with coordinates for d1d2qb_.
(The format of our PDB-style files is described here.)

Timeline for d1d2qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d2qa_