Lineage for d2foka2 (2fok A:144-286)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259031Family a.4.5.12: Restriction endonuclease FokI, N-terminal (recognition) domain [46824] (1 protein)
  6. 1259032Protein Restriction endonuclease FokI, N-terminal (recognition) domain [46825] (1 species)
    duplication: consists of three elaborated "winged helix" domains
  7. 1259033Species Flavobacterium okeanokoites [TaxId:244] [46826] (2 PDB entries)
  8. 1259035Domain d2foka2: 2fok A:144-286 [16132]
    Other proteins in same PDB: d2foka4, d2fokb4

Details for d2foka2

PDB Entry: 2fok (more details), 2.3 Å

PDB Description: structure of restriction endonuclease foki
PDB Compounds: (A:) foki restriction endonuclease

SCOPe Domain Sequences for d2foka2:

Sequence, based on SEQRES records: (download)

>d2foka2 a.4.5.12 (A:144-286) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites [TaxId: 244]}
gsaiekeilieaissyppairiltlledgqhltkfdlgknlgfsgesgftslpegilldt
lanampkdkgeirnnwegssdkyarmiggwldklglvkqgkkefiiptlgkpdnkefish
afkitgeglkvlrrakgstkftr

Sequence, based on observed residues (ATOM records): (download)

>d2foka2 a.4.5.12 (A:144-286) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites [TaxId: 244]}
gsaiekeilieaissyppairiltlledgqhltkfdlgknlgfsgesgftslpegilldt
lanampkdkgeirnnwegssdkyarmiggwldklglvkqgkkefiiptnkefishafkit
geglkvlrrakgstkftr

SCOPe Domain Coordinates for d2foka2:

Click to download the PDB-style file with coordinates for d2foka2.
(The format of our PDB-style files is described here.)

Timeline for d2foka2: