Lineage for d1fnnb1 (1fnn B:277-388)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45587Family a.4.5.11: Helicase DNA-binding domain [46819] (2 proteins)
  6. 45588Protein CDC6, C-terminal domain [46822] (1 species)
  7. 45589Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [46823] (1 PDB entry)
  8. 45591Domain d1fnnb1: 1fnn B:277-388 [16130]
    Other proteins in same PDB: d1fnna2, d1fnnb2

Details for d1fnnb1

PDB Entry: 1fnn (more details), 2 Å

PDB Description: crystal structure of cdc6p from pyrobaculum aerophilum

SCOP Domain Sequences for d1fnnb1:

Sequence, based on SEQRES records: (download)

>d1fnnb1 a.4.5.11 (B:277-388) CDC6, C-terminal domain {Archaeon Pyrobaculum aerophilum}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnkrgegvrgrttlisigtepldtleavitklikeelr

Sequence, based on observed residues (ATOM records): (download)

>d1fnnb1 a.4.5.11 (B:277-388) CDC6, C-terminal domain {Archaeon Pyrobaculum aerophilum}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnttlisigtepldtleavitklikeelr

SCOP Domain Coordinates for d1fnnb1:

Click to download the PDB-style file with coordinates for d1fnnb1.
(The format of our PDB-style files is described here.)

Timeline for d1fnnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnnb2