Lineage for d1fnnb1 (1fnn B:277-388)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693240Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
    follows the extended AAA-ATPase domain
  6. 2693241Protein CDC6, C-terminal domain [46822] (1 species)
    contains the N- and C-terminal helical extensions to the common fold
  7. 2693242Species Pyrobaculum aerophilum [TaxId:13773] [46823] (1 PDB entry)
  8. 2693244Domain d1fnnb1: 1fnn B:277-388 [16130]
    Other proteins in same PDB: d1fnna2, d1fnnb2
    complexed with adp, mg

Details for d1fnnb1

PDB Entry: 1fnn (more details), 2 Å

PDB Description: crystal structure of cdc6p from pyrobaculum aerophilum
PDB Compounds: (B:) cell division control protein 6

SCOPe Domain Sequences for d1fnnb1:

Sequence, based on SEQRES records: (download)

>d1fnnb1 a.4.5.11 (B:277-388) CDC6, C-terminal domain {Pyrobaculum aerophilum [TaxId: 13773]}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnkrgegvrgrttlisigtepldtleavitklikeelr

Sequence, based on observed residues (ATOM records): (download)

>d1fnnb1 a.4.5.11 (B:277-388) CDC6, C-terminal domain {Pyrobaculum aerophilum [TaxId: 13773]}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnttlisigtepldtleavitklikeelr

SCOPe Domain Coordinates for d1fnnb1:

Click to download the PDB-style file with coordinates for d1fnnb1.
(The format of our PDB-style files is described here.)

Timeline for d1fnnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnnb2