Lineage for d1hqcb1 (1hqc B:243-318)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95272Family a.4.5.11: Helicase DNA-binding domain [46819] (2 proteins)
  6. 95277Protein Holliday junction helicase RuvB [46820] (2 species)
  7. 95285Species Thermus thermophilus [TaxId:274] [46821] (1 PDB entry)
  8. 95287Domain d1hqcb1: 1hqc B:243-318 [16128]
    Other proteins in same PDB: d1hqca2, d1hqcb2

Details for d1hqcb1

PDB Entry: 1hqc (more details), 3.2 Å

PDB Description: structure of ruvb from thermus thermophilus hb8

SCOP Domain Sequences for d1hqcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqcb1 a.4.5.11 (B:243-318) Holliday junction helicase RuvB {Thermus thermophilus}
lglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgr
vptelayrhlgypppv

SCOP Domain Coordinates for d1hqcb1:

Click to download the PDB-style file with coordinates for d1hqcb1.
(The format of our PDB-style files is described here.)

Timeline for d1hqcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hqcb2