Lineage for d1hqcb1 (1hqc B:243-318)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693240Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
    follows the extended AAA-ATPase domain
  6. 2693252Protein Holliday junction helicase RuvB [46820] (2 species)
  7. 2693260Species Thermus thermophilus [TaxId:274] [46821] (3 PDB entries)
  8. 2693263Domain d1hqcb1: 1hqc B:243-318 [16128]
    Other proteins in same PDB: d1hqca2, d1hqcb2
    complexed with ade, mg

Details for d1hqcb1

PDB Entry: 1hqc (more details), 3.2 Å

PDB Description: structure of ruvb from thermus thermophilus hb8
PDB Compounds: (B:) ruvb

SCOPe Domain Sequences for d1hqcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqcb1 a.4.5.11 (B:243-318) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}
lglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgr
vptelayrhlgypppv

SCOPe Domain Coordinates for d1hqcb1:

Click to download the PDB-style file with coordinates for d1hqcb1.
(The format of our PDB-style files is described here.)

Timeline for d1hqcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hqcb2