SCOPe 2.07: Domain d1hqca1: 1hqc A:243-318

Lineage for d1hqca1 (1hqc A:243-318)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
   follows the extended AAA-ATPase domain

6. Protein Holliday junction helicase RuvB [46820] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46821] (3 PDB entries)

8. Domain d1hqca1: 1hqc A:243-318 [16127]
   Other proteins in same PDB: d1hqca2, d1hqcb2
   complexed with ade, mg

Details for d1hqca1

PDB Entry: 1hqc, 3.2 Å

PDB Description: structure of ruvb from thermus thermophilus hb8

PDB Compounds: (A:) ruvb

SCOPe Domain Sequences for d1hqca1:

Sequence; same for both SEQRES and ATOM records:

>d1hqca1 a.4.5.11 (A:243-318) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}
lglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgr
vptelayrhlgypppv

Timeline for d1hqca1:

• d1hqca1 first appeared (with stable ids) in SCOP 1.55
  
• d1hqca1 appears in SCOPe 2.06
  
• d1hqca1 appears in the current release, SCOPe 2.08