| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins) follows the extended AAA-ATPase domain |
| Protein Holliday junction helicase RuvB [46820] (2 species) |
| Species Thermus thermophilus [TaxId:274] [46821] (3 PDB entries) |
| Domain d1hqca1: 1hqc A:243-318 [16127] Other proteins in same PDB: d1hqca2, d1hqcb2 complexed with ade, mg |
PDB Entry: 1hqc (more details), 3.2 Å
SCOPe Domain Sequences for d1hqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqca1 a.4.5.11 (A:243-318) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}
lglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgr
vptelayrhlgypppv
Timeline for d1hqca1: