Lineage for d1repc1 (1rep C:15-143)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693223Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
    duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry
  6. 2693224Protein RepE54 [46817] (1 species)
  7. 2693225Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries)
  8. 2693226Domain d1repc1: 1rep C:15-143 [16125]
    protein/DNA complex; complexed with mg

Details for d1repc1

PDB Entry: 1rep (more details), 2.6 Å

PDB Description: crystal structure of replication initiator protein repe54 of mini-f plasmid complexed with an iteron dna
PDB Compounds: (C:) protein (replication initiation protein)

SCOPe Domain Sequences for d1repc1:

Sequence, based on SEQRES records: (download)

>d1repc1 a.4.5.10 (C:15-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
sprivqsndlteaayslsrdqkrmlylfvdqirksdgtlqehdgiceihvakyaeifglt
saeaskdirqalksfagkevvfyrpeedagdekgyesfpwfikpahspsrglysvhinpy
lipffiglq

Sequence, based on observed residues (ATOM records): (download)

>d1repc1 a.4.5.10 (C:15-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
sprivqsndlteaayslsrdqkrmlylfvdqirkshdgiceihvakyaeifgltsaeask
dirqalksfagkevvfyesfpwfikpahspsrglysvhinpylipffiglq

SCOPe Domain Coordinates for d1repc1:

Click to download the PDB-style file with coordinates for d1repc1.
(The format of our PDB-style files is described here.)

Timeline for d1repc1: