SCOPe 2.07: Domain d1repc1: 1rep C:15-143

Lineage for d1repc1 (1rep C:15-143)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.10: Replication initiation protein [46816] (3 protein domains)
   duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry

6. Protein RepE54 [46817] (1 species)

7. Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries)

8. Domain d1repc1: 1rep C:15-143 [16125]
   protein/DNA complex; complexed with mg

Details for d1repc1

PDB Entry: 1rep, 2.6 Å

PDB Description: crystal structure of replication initiator protein repe54 of mini-f plasmid complexed with an iteron dna

PDB Compounds: (C:) protein (replication initiation protein)

SCOPe Domain Sequences for d1repc1:

Sequence, based on SEQRES records:

>d1repc1 a.4.5.10 (C:15-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
sprivqsndlteaayslsrdqkrmlylfvdqirksdgtlqehdgiceihvakyaeifglt
saeaskdirqalksfagkevvfyrpeedagdekgyesfpwfikpahspsrglysvhinpy
lipffiglq

Sequence, based on observed residues (ATOM records):

>d1repc1 a.4.5.10 (C:15-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
sprivqsndlteaayslsrdqkrmlylfvdqirkshdgiceihvakyaeifgltsaeask
dirqalksfagkevvfyesfpwfikpahspsrglysvhinpylipffiglq

Timeline for d1repc1:

• d1repc1 first appeared (with stable ids) in SCOP 1.55
  
• d1repc1 appears in SCOPe 2.06