SCOPe 2.06: Domain d1i1sa_: 1i1s A:

Lineage for d1i1sa_ (1i1s A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.9: Transcription factor MotA, activation domain [46813] (1 protein)
   The N- and C-terminal helical extensions to the common fold form the dimer interface (distinct from that of ArsR-like family)
   automatically mapped to Pfam PF09114

6. Protein Transcription factor MotA, activation domain [46814] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [46815] (2 PDB entries)

8. Domain d1i1sa_: 1i1s A: [16124]

Details for d1i1sa_

PDB Entry: 1i1s

PDB Description: solution structure of the transcriptional activation domain of the bacteriophage t4 protein mota

PDB Compounds: (A:) mota

SCOPe Domain Sequences for d1i1sa_:

Sequence; same for both SEQRES and ATOM records:

>d1i1sa_ a.4.5.9 (A:) Transcription factor MotA, activation domain {Bacteriophage T4 [TaxId: 10665]}
mskvtyiikasndvlnektatilitiakkdfitaaevrevhpdlgnavvnsnigvlikkg
lveksgdgliitgeaqdiisnaatlyaqenapellk

Timeline for d1i1sa_:

• d1i1sa_ first appeared (with stable ids) in SCOP 1.55
  
• d1i1sa_ appears in SCOPe 2.05
  
• d1i1sa_ appears in SCOPe 2.07
  
• d1i1sa_ appears in the current release, SCOPe 2.08