SCOPe 2.08: Domain d1bjab_: 1bja B:

Lineage for d1bjab_ (1bja B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.9: Transcription factor MotA, activation domain [46813] (1 protein)
   The N- and C-terminal helical extensions to the common fold form the dimer interface (distinct from that of ArsR-like family)
   automatically mapped to Pfam PF09114

6. Protein Transcription factor MotA, activation domain [46814] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [46815] (2 PDB entries)

8. Domain d1bjab_: 1bja B: [16123]
   complexed with so4

Details for d1bjab_

PDB Entry: 1bja, 2.19 Å

PDB Description: activation domain of the phage t4 transcription factor mota

PDB Compounds: (B:) transcription regulatory protein mota

SCOPe Domain Sequences for d1bjab_:

Sequence; same for both SEQRES and ATOM records:

>d1bjab_ a.4.5.9 (B:) Transcription factor MotA, activation domain {Bacteriophage T4 [TaxId: 10665]}
skvtyiikasndvlnektatilitiakkdfitaaevrevhpdlgnavvnsnigvlikkgl
veksgdgliitgeaqdiisnaatlyaqenapellk

Timeline for d1bjab_:

• d1bjab_ first appeared (with stable ids) in SCOP 1.55
  
• d1bjab_ appears in SCOPe 2.07