| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.9: Transcription factor MotA, activation domain [46813] (1 protein) The N- and C-terminal helical extensions to the common fold form the dimer interface (distinct from that of ArsR-like family) automatically mapped to Pfam PF09114 |
| Protein Transcription factor MotA, activation domain [46814] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [46815] (2 PDB entries) |
| Domain d1bjab_: 1bja B: [16123] complexed with so4 |
PDB Entry: 1bja (more details), 2.19 Å
SCOPe Domain Sequences for d1bjab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjab_ a.4.5.9 (B:) Transcription factor MotA, activation domain {Bacteriophage T4 [TaxId: 10665]}
skvtyiikasndvlnektatilitiakkdfitaaevrevhpdlgnavvnsnigvlikkgl
veksgdgliitgeaqdiisnaatlyaqenapellk
Timeline for d1bjab_: