SCOP 1.55: Domain d1b9mb1: 1b9m B:-1-126

Lineage for d1b9mb1 (1b9m B:-1-126)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families)

5. Family a.4.5.8: N-terminal domain of molybdate-dependent transcriptional regulator ModE [46810] (1 protein)

6. Protein N-terminal domain of molybdate-dependent transcriptional regulator ModE [46811] (1 species)

7. Species Escherichia coli [TaxId:562] [46812] (2 PDB entries)

8. Domain d1b9mb1: 1b9m B:-1-126 [16119]
   Other proteins in same PDB: d1b9ma2, d1b9mb2

Details for d1b9mb1

PDB Entry: 1b9m, 1.75 Å

PDB Description: regulator from escherichia coli

SCOP Domain Sequences for d1b9mb1:

Sequence, based on SEQRES records:

>d1b9mb1 a.4.5.8 (B:-1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli}
hmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqls
ehilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaais
rfslqts

Sequence, based on observed residues (ATOM records):

>d1b9mb1 a.4.5.8 (B:-1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli}
hmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqls
ehilveravltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslqts

Timeline for d1b9mb1:

• d1b9mb1 appears in SCOP 1.57
  
• d1b9mb1 appears in the current release, SCOPe 2.08