SCOPe 2.08: Domain d1b9ma1: 1b9m A:-1-126

Lineage for d1b9ma1 (1b9m A:-1-126)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.8: N-terminal domain of molybdate-dependent transcriptional regulator ModE [46810] (1 protein)
   contains beta-hairpin in the N-terminal extension and two helices in the C-terminal extension

6. Protein N-terminal domain of molybdate-dependent transcriptional regulator ModE [46811] (1 species)

7. Species Escherichia coli [TaxId:562] [46812] (3 PDB entries)

8. Domain d1b9ma1: 1b9m A:-1-126 [16118]
   Other proteins in same PDB: d1b9ma3, d1b9ma4, d1b9mb3, d1b9mb4
   complexed with ni

Details for d1b9ma1

PDB Entry: 1b9m, 1.75 Å

PDB Description: regulator from escherichia coli

PDB Compounds: (A:) protein (mode)

SCOPe Domain Sequences for d1b9ma1:

Sequence, based on SEQRES records:

>d1b9ma1 a.4.5.8 (A:-1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
hmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqls
ehilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaais
rfslqts

Sequence, based on observed residues (ATOM records):

>d1b9ma1 a.4.5.8 (A:-1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
hmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqls
ehilveratggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslq
ts

Timeline for d1b9ma1:

• d1b9ma1 first appeared (with stable ids) in SCOP 1.55
  
• d1b9ma1 appears in SCOPe 2.07