Lineage for d1bm9b_ (1bm9 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693186Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
    automatically mapped to Pfam PF02334
  6. 2693187Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 2693188Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries)
  8. 2693190Domain d1bm9b_: 1bm9 B: [16117]
    CASP1

Details for d1bm9b_

PDB Entry: 1bm9 (more details), 2 Å

PDB Description: replication terminator protein from bacillus subtilis
PDB Compounds: (B:) replication terminator protein

SCOPe Domain Sequences for d1bm9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bm9b_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
eekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslh
ellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

SCOPe Domain Coordinates for d1bm9b_:

Click to download the PDB-style file with coordinates for d1bm9b_.
(The format of our PDB-style files is described here.)

Timeline for d1bm9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bm9a_