Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein) automatically mapped to Pfam PF02334 |
Protein Replication terminator protein (RTP) [46808] (1 species) contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer |
Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries) |
Domain d1bm9a_: 1bm9 A: [16116] CASP1 |
PDB Entry: 1bm9 (more details), 2 Å
SCOPe Domain Sequences for d1bm9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bm9a_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]} eekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslh ellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf
Timeline for d1bm9a_: