Lineage for d1hw2b1 (1hw2 B:7-78)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1479Family a.4.5.6: GntR-like transcriptional regulators [46804] (1 protein)
  6. 1480Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species)
  7. 1481Species Escherichia coli [TaxId:562] [46806] (3 PDB entries)
  8. 1486Domain d1hw2b1: 1hw2 B:7-78 [16115]
    Other proteins in same PDB: d1hw2a2, d1hw2b2

Details for d1hw2b1

PDB Entry: 1hw2 (more details), 3.25 Å

PDB Description: fadr-dna complex: transcriptional control of fatty acid metabolism in echerichia coli

SCOP Domain Sequences for d1hw2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw2b1 a.4.5.6 (B:7-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli}
spagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiqhg
kptkvnnfwets

SCOP Domain Coordinates for d1hw2b1:

Click to download the PDB-style file with coordinates for d1hw2b1.
(The format of our PDB-style files is described here.)

Timeline for d1hw2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hw2b2