Lineage for d1ft9b1 (1ft9 B:134-213)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982714Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 1982789Protein CO-sensing protein CooA, C-terminal domain [46799] (1 species)
  7. 1982790Species Rhodospirillum rubrum [TaxId:1085] [46800] (1 PDB entry)
  8. 1982792Domain d1ft9b1: 1ft9 B:134-213 [16108]
    Other proteins in same PDB: d1ft9a2, d1ft9b2
    complexed with hem

Details for d1ft9b1

PDB Entry: 1ft9 (more details), 2.6 Å

PDB Description: structure of the reduced (feii) co-sensing protein from r. rubrum
PDB Compounds: (B:) carbon monoxide oxidation system transcription regulator

SCOPe Domain Sequences for d1ft9b1:

Sequence, based on SEQRES records: (download)

>d1ft9b1 a.4.5.4 (B:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]}
dikqriagffidhanttgrqtqggvivsvdftveeianligssrqttstalnslikegyi
srqgrghytipnlvrlkaaa

Sequence, based on observed residues (ATOM records): (download)

>d1ft9b1 a.4.5.4 (B:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]}
dikqriagffidhanttgvivsvdftveeianligssrqttstalnslikegyisrqgrg
hytipnlvrlkaaa

SCOPe Domain Coordinates for d1ft9b1:

Click to download the PDB-style file with coordinates for d1ft9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ft9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ft9b2