Lineage for d1ft9a1 (1ft9 A:134-213)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1454Family a.4.5.4: CAP C-terminal domain-like [46796] (2 proteins)
  6. 1470Protein CO-sensing protein CooA, C-terminal domain [46799] (1 species)
  7. 1471Species Rhodospirillum rubrum [TaxId:1085] [46800] (1 PDB entry)
  8. 1472Domain d1ft9a1: 1ft9 A:134-213 [16107]
    Other proteins in same PDB: d1ft9a2, d1ft9b2

Details for d1ft9a1

PDB Entry: 1ft9 (more details), 2.6 Å

PDB Description: structure of the reduced (feii) co-sensing protein from r. rubrum

SCOP Domain Sequences for d1ft9a1:

Sequence, based on SEQRES records: (download)

>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum}
dikqriagffidhanttgrqtqggvivsvdftveeianligssrqttstalnslikegyi
srqgrghytipnlvrlkaaa

Sequence, based on observed residues (ATOM records): (download)

>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum}
dikqriagffidhanttgrqtgvivsvdftveeianligssrqttstalnslikegyisr
qgrghytipnlvrlkaaa

SCOP Domain Coordinates for d1ft9a1:

Click to download the PDB-style file with coordinates for d1ft9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ft9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ft9a2