SCOPe 2.08: Domain d1ruoa1: 1ruo A:138-206

Lineage for d1ruoa1 (1ruo A:138-206)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)

8. Domain d1ruoa1: 1ruo A:138-206 [16105]
   Other proteins in same PDB: d1ruoa2, d1ruob2
   protein/DNA complex; complexed with cmp; mutant

Details for d1ruoa1

PDB Entry: 1ruo, 2.7 Å

PDB Description: catabolite gene activator protein (cap) mutant/dna complex + adenosine-3',5'-cyclic-monophosphate

PDB Compounds: (A:) protein (catabolite gene activator protein (cap))

SCOPe Domain Sequences for d1ruoa1:

Sequence; same for both SEQRES and ATOM records:

>d1ruoa1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsrftvgrilkmledqnlis
ahgktivvy

Timeline for d1ruoa1:

• d1ruoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1ruoa1 appears in SCOPe 2.07