SCOP 1.75: Domain d1runb1: 1run B:138-205

Lineage for d1runb1 (1run B:138-205)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (19 PDB entries)

8. Domain d1runb1: 1run B:138-205 [16104]
   Other proteins in same PDB: d1runa2, d1runb2
   protein/DNA complex; complexed with cmp

Details for d1runb1

PDB Entry: 1run, 2.7 Å

PDB Description: catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate

PDB Compounds: (B:) protein (catabolite gene activator protein (cap))

SCOP Domain Sequences for d1runb1:

Sequence; same for both SEQRES and ATOM records:

>d1runb1 a.4.5.4 (B:138-205) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivv

Timeline for d1runb1:

• d1runb1 first appeared (with stable ids) in SCOP 1.55
  
• d1runb1 appears in SCOP 1.73
  
• d1runb1 appears in SCOPe 2.01
  
• d1runb1 appears in the current release, SCOPe 2.08