Lineage for d1g6na1 (1g6n A:138-206)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982714Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 1982715Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 1982716Species Escherichia coli [TaxId:562] [46798] (27 PDB entries)
  8. 1982727Domain d1g6na1: 1g6n A:138-206 [16100]
    Other proteins in same PDB: d1g6na2, d1g6nb2
    complexed with cmp

Details for d1g6na1

PDB Entry: 1g6n (more details), 2.1 Å

PDB Description: 2.1 angstrom structure of cap-camp
PDB Compounds: (A:) catabolite gene activator protein

SCOPe Domain Sequences for d1g6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6na1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvy

SCOPe Domain Coordinates for d1g6na1:

Click to download the PDB-style file with coordinates for d1g6na1.
(The format of our PDB-style files is described here.)

Timeline for d1g6na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g6na2