Lineage for d1hw5a1 (1hw5 A:138-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693005Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2693006Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 2693007Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)
  8. 2693016Domain d1hw5a1: 1hw5 A:138-208 [16098]
    Other proteins in same PDB: d1hw5a2, d1hw5b2
    complexed with cmp

Details for d1hw5a1

PDB Entry: 1hw5 (more details), 1.82 Å

PDB Description: the cap/crp variant t127l/s128a
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d1hw5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw5a1 a.4.5.4 (A:138-208) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygt

SCOPe Domain Coordinates for d1hw5a1:

Click to download the PDB-style file with coordinates for d1hw5a1.
(The format of our PDB-style files is described here.)

Timeline for d1hw5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hw5a2