Lineage for d1cgpb1 (1cgp B:138-205)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1454Family a.4.5.4: CAP C-terminal domain-like [46796] (2 protein domains)
  6. 1455Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
  7. 1456Species Escherichia coli [TaxId:562] [46798] (7 PDB entries)
  8. 1465Domain d1cgpb1: 1cgp B:138-205 [16097]
    Other proteins in same PDB: d1cgpa2, d1cgpb2

Details for d1cgpb1

PDB Entry: 1cgp (more details), 3 Å

PDB Description: catabolite gene activator protein (cap)/dna complex + adenosine-3',5'- cyclic-monophosphate

SCOP Domain Sequences for d1cgpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgpb1 a.4.5.4 (B:138-205) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivv

SCOP Domain Coordinates for d1cgpb1:

Click to download the PDB-style file with coordinates for d1cgpb1.
(The format of our PDB-style files is described here.)

Timeline for d1cgpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cgpb2