Lineage for d1b4af1 (1b4a F:4-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2692979Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (2 proteins)
    automatically mapped to Pfam PF01316
  6. 2692980Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)
  7. 2692981Species Bacillus stearothermophilus [TaxId:1422] [46795] (1 PDB entry)
  8. 2692987Domain d1b4af1: 1b4a F:4-78 [16093]
    Other proteins in same PDB: d1b4aa2, d1b4ab2, d1b4ac2, d1b4ad2, d1b4ae2, d1b4af2

Details for d1b4af1

PDB Entry: 1b4a (more details), 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus
PDB Compounds: (F:) Arginine repressor

SCOPe Domain Sequences for d1b4af1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4af1 a.4.5.3 (F:4-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus stearothermophilus [TaxId: 1422]}
gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
lpsdqrfnplqklkr

SCOPe Domain Coordinates for d1b4af1:

Click to download the PDB-style file with coordinates for d1b4af1.
(The format of our PDB-style files is described here.)

Timeline for d1b4af1: