SCOPe 2.08: Domain d1b4ab1: 1b4a B:4-78

Lineage for d1b4ab1 (1b4a B:4-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (2 proteins)
   automatically mapped to Pfam PF01316

6. Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [46795] (1 PDB entry)

8. Domain d1b4ab1: 1b4a B:4-78 [16089]
   Other proteins in same PDB: d1b4aa2, d1b4ab2, d1b4ac2, d1b4ad2, d1b4ae2, d1b4af2

Details for d1b4ab1

PDB Entry: 1b4a, 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus

PDB Compounds: (B:) Arginine repressor

SCOPe Domain Sequences for d1b4ab1:

Sequence; same for both SEQRES and ATOM records:

>d1b4ab1 a.4.5.3 (B:4-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus stearothermophilus [TaxId: 1422]}
gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
lpsdqrfnplqklkr

Timeline for d1b4ab1:

• d1b4ab1 first appeared (with stable ids) in SCOP 1.55
  
• d1b4ab1 appears in SCOPe 2.07