| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.2: LexA repressor, N-terminal DNA-binding domain [46789] (1 protein) automatically mapped to Pfam PF01726 |
| Protein LexA repressor, N-terminal DNA-binding domain [46790] (1 species) |
| Species Escherichia coli [TaxId:562] [46791] (4 PDB entries) |
| Domain d1leba_: 1leb A: [16086] |
PDB Entry: 1leb (more details)
SCOPe Domain Sequences for d1leba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1leba_ a.4.5.2 (A:) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]}
mkaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivs
gasrgirllqee
Timeline for d1leba_: