SCOPe 2.08: Domain d1leaa_: 1lea A:

Lineage for d1leaa_ (1lea A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.2: LexA repressor, N-terminal DNA-binding domain [46789] (1 protein)
   automatically mapped to Pfam PF01726

6. Protein LexA repressor, N-terminal DNA-binding domain [46790] (1 species)

7. Species Escherichia coli [TaxId:562] [46791] (4 PDB entries)

8. Domain d1leaa_: 1lea A: [16085]

Details for d1leaa_

PDB Entry: 1lea

PDB Description: solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy

PDB Compounds: (A:) lexa repressor DNA binding domain

SCOPe Domain Sequences for d1leaa_:

Sequence; same for both SEQRES and ATOM records:

>d1leaa_ a.4.5.2 (A:) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]}
mkaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivs
gasrgirllqee

Timeline for d1leaa_:

• d1leaa_ first appeared (with stable ids) in SCOP 1.55, called d1lea__
  
• d1leaa_ appears in SCOPe 2.07