SCOP 1.75: Domain d1biba1: 1bib A:2-63

Lineage for d1biba1 (1bib A:2-63)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.1: Biotin repressor-like [46786] (2 proteins)

6. Protein Biotin repressor, N-terminal domain [46787] (1 species)
   the middle domain is an alpha+beta fold somewhat similar to the SH2 fold
   C-terminal domain has SH3-like common fold

7. Species Escherichia coli [TaxId:562] [46788] (4 PDB entries)

8. Domain d1biba1: 1bib A:2-63 [16084]
   Other proteins in same PDB: d1biba2, d1biba3
   complexed with btn

Details for d1biba1

PDB Entry: 1bib, 2.8 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

PDB Compounds: (A:) bir a

SCOP Domain Sequences for d1biba1:

Sequence; same for both SEQRES and ATOM records:

>d1biba1 a.4.5.1 (A:2-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]}
kdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslp
ep

Timeline for d1biba1:

• d1biba1 first appeared (with stable ids) in SCOP 1.55, called d1bib_1
  
• d1biba1 appears in SCOP 1.73
  
• d1biba1 appears in SCOPe 2.01
  
• d1biba1 appears in the current release, SCOPe 2.08