Lineage for d1bib_1 (1bib 2-63)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1433Family a.4.5.1: Biotin repressor, N-terminal domain [46786] (1 protein)
  6. 1434Protein Biotin repressor, N-terminal domain [46787] (1 species)
  7. 1435Species Escherichia coli [TaxId:562] [46788] (2 PDB entries)
  8. 1437Domain d1bib_1: 1bib 2-63 [16084]
    Other proteins in same PDB: d1bib_2, d1bib_3

Details for d1bib_1

PDB Entry: 1bib (more details), 2.8 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bib_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bib_1 a.4.5.1 (2-63) Biotin repressor, N-terminal domain {Escherichia coli}
kdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslp
ep

SCOP Domain Coordinates for d1bib_1:

Click to download the PDB-style file with coordinates for d1bib_1.
(The format of our PDB-style files is described here.)

Timeline for d1bib_1: