Lineage for d1biaa1 (1bia A:1-63)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1258751Family a.4.5.1: Biotin repressor-like [46786] (2 proteins)
    automatically mapped to Pfam PF08279
  6. 1258752Protein Biotin repressor, N-terminal domain [46787] (1 species)
    the middle domain is an alpha+beta fold somewhat similar to the SH2 fold
    C-terminal domain has SH3-like common fold
  7. 1258753Species Escherichia coli [TaxId:562] [46788] (4 PDB entries)
  8. 1258754Domain d1biaa1: 1bia A:1-63 [16083]
    Other proteins in same PDB: d1biaa2, d1biaa3

Details for d1biaa1

PDB Entry: 1bia (more details), 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains
PDB Compounds: (A:) BirA BIFUNCTIONAL PROTEIN

SCOPe Domain Sequences for d1biaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]}
mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
pep

SCOPe Domain Coordinates for d1biaa1:

Click to download the PDB-style file with coordinates for d1biaa1.
(The format of our PDB-style files is described here.)

Timeline for d1biaa1: