| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.1: Biotin repressor-like [46786] (2 proteins) |
| Protein Biotin repressor, N-terminal domain [46787] (1 species) the middle domain is an alpha+beta fold somewhat similar to the SH2 fold C-terminal domain has SH3-like common fold |
| Species Escherichia coli [TaxId:562] [46788] (3 PDB entries) |
| Domain d1bia_1: 1bia 1-63 [16083] Other proteins in same PDB: d1bia_2, d1bia_3 |
PDB Entry: 1bia (more details), 2.3 Å
SCOP Domain Sequences for d1bia_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bia_1 a.4.5.1 (1-63) Biotin repressor, N-terminal domain {Escherichia coli}
mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
pep
Timeline for d1bia_1: