Lineage for d1bia_1 (1bia 1-63)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351618Family a.4.5.1: Biotin repressor-like [46786] (2 proteins)
  6. 351619Protein Biotin repressor, N-terminal domain [46787] (1 species)
    the middle domain is an alpha+beta fold somewhat similar to the SH2 fold
    C-terminal domain has SH3-like common fold
  7. 351620Species Escherichia coli [TaxId:562] [46788] (3 PDB entries)
  8. 351621Domain d1bia_1: 1bia 1-63 [16083]
    Other proteins in same PDB: d1bia_2, d1bia_3

Details for d1bia_1

PDB Entry: 1bia (more details), 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bia_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bia_1 a.4.5.1 (1-63) Biotin repressor, N-terminal domain {Escherichia coli}
mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
pep

SCOP Domain Coordinates for d1bia_1:

Click to download the PDB-style file with coordinates for d1bia_1.
(The format of our PDB-style files is described here.)

Timeline for d1bia_1: