SCOP 1.57: Domain d1bia_1: 1bia 1-63

Lineage for d1bia_1 (1bia 1-63)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.1: Biotin repressor, N-terminal domain [46786] (1 protein)

6. Protein Biotin repressor, N-terminal domain [46787] (1 species)

7. Species Escherichia coli [TaxId:562] [46788] (3 PDB entries)

8. Domain d1bia_1: 1bia 1-63 [16083]
   Other proteins in same PDB: d1bia_2, d1bia_3

Details for d1bia_1

PDB Entry: 1bia, 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bia_1:

Sequence; same for both SEQRES and ATOM records:

>d1bia_1 a.4.5.1 (1-63) Biotin repressor, N-terminal domain {Escherichia coli}
mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
pep

Timeline for d1bia_1:

• d1bia_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bia_1 appears in SCOP 1.59
  
• d1bia_1 appears in the current release, SCOPe 2.08, called d1biaa1