SCOP 1.57: Domain d1f1zb1: 1f1z B:169-267

Lineage for d1f1zb1 (1f1z B:169-267)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.27: TnsA endonuclease, C-terminal domain [46782] (1 protein)

6. Protein TnsA endonuclease, C-terminal domain [46783] (1 species)

7. Species Escherichia coli [TaxId:562] [46784] (1 PDB entry)

8. Domain d1f1zb1: 1f1z B:169-267 [16082]
   Other proteins in same PDB: d1f1za2, d1f1zb2

Details for d1f1zb1

PDB Entry: 1f1z, 2.4 Å

PDB Description: tnsa, a catalytic component of the tn7 transposition system

SCOP Domain Sequences for d1f1zb1:

Sequence; same for both SEQRES and ATOM records:

>d1f1zb1 a.4.5.27 (B:169-267) TnsA endonuclease, C-terminal domain {Escherichia coli}
npvvkeniewlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgkt
lseiraltangfikfniyksfrankcadlcisqvvnmee

Timeline for d1f1zb1:

• d1f1zb1 first appeared (with stable ids) in SCOP 1.55
  
• d1f1zb1 appears in SCOP 1.59
  
• d1f1zb1 appears in the current release, SCOPe 2.08