SCOP 1.75: Domain d1f1za1: 1f1z A:169-267

Lineage for d1f1za1 (1f1z A:169-267)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.27: TnsA endonuclease, C-terminal domain [46782] (1 protein)

6. Protein TnsA endonuclease, C-terminal domain [46783] (1 species)

7. Species Escherichia coli [TaxId:562] [46784] (2 PDB entries)
   Uniprot P13988

8. Domain d1f1za1: 1f1z A:169-267 [16081]
   Other proteins in same PDB: d1f1za2, d1f1zb2

Details for d1f1za1

PDB Entry: 1f1z, 2.4 Å

PDB Description: tnsa, a catalytic component of the tn7 transposition system

PDB Compounds: (A:) tnsa endonuclease

SCOP Domain Sequences for d1f1za1:

Sequence; same for both SEQRES and ATOM records:

>d1f1za1 a.4.5.27 (A:169-267) TnsA endonuclease, C-terminal domain {Escherichia coli [TaxId: 562]}
npvvkeniewlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgkt
lseiraltangfikfniyksfrankcadlcisqvvnmee

Timeline for d1f1za1:

• d1f1za1 first appeared (with stable ids) in SCOP 1.55
  
• d1f1za1 appears in SCOP 1.73
  
• d1f1za1 appears in SCOPe 2.01
  
• d1f1za1 appears in the current release, SCOPe 2.08