Lineage for d1f1za1 (1f1z A:169-267)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1426Superfamily a.4.4: TnsA endonuclease, C-terminal domain [46781] (1 family) (S)
  5. 1427Family a.4.4.1: TnsA endonuclease, C-terminal domain [46782] (1 protein)
  6. 1428Protein TnsA endonuclease, C-terminal domain [46783] (1 species)
  7. 1429Species Escherichia coli [TaxId:562] [46784] (1 PDB entry)
  8. 1430Domain d1f1za1: 1f1z A:169-267 [16081]
    Other proteins in same PDB: d1f1za2, d1f1zb2

Details for d1f1za1

PDB Entry: 1f1z (more details), 2.4 Å

PDB Description: tnsa, a catalytic component of the tn7 transposition system

SCOP Domain Sequences for d1f1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1za1 a.4.4.1 (A:169-267) TnsA endonuclease, C-terminal domain {Escherichia coli}
npvvkeniewlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgkt
lseiraltangfikfniyksfrankcadlcisqvvnmee

SCOP Domain Coordinates for d1f1za1:

Click to download the PDB-style file with coordinates for d1f1za1.
(The format of our PDB-style files is described here.)

Timeline for d1f1za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f1za2