| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) ![]() automatically mapped to Pfam PF01035 |
| Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins) |
| Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries) Uniprot P16455 6-176 |
| Domain d1eh8a1: 1eh8 A:92-179 [16077] Other proteins in same PDB: d1eh8a2 complexed with zn |
PDB Entry: 1eh8 (more details), 2.5 Å
SCOPe Domain Sequences for d1eh8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eh8a1 a.4.2.1 (A:92-179) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghrlgkp
Timeline for d1eh8a1: